PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004486782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB_related
Protein Properties Length: 348aa    MW: 38048.6 Da    PI: 7.8258
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004486782.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.5e-14107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
   XP_004486782.1 107 PWTEEEHRLFLVGLRKLGKGDWRGIARNFVVSRTPTQVASHAQKY 151
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.629100156IPR017930Myb domain
SuperFamilySSF466891.27E-16102156IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-18103155IPR006447Myb domain, plants
SMARTSM007171.8E-11104154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-11104150IPR009057Homeodomain-like
PfamPF002491.7E-11107151IPR001005SANT/Myb domain
CDDcd001678.40E-10107152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGAGVKIFG VRLTDGSIIQ KSASMGNLTL ANHHHCSSSS  60
STYAGSSLNP GSPCSDPPHD PDGYLSDDPA HASTFATRRG EKKKGVPWTE EEHRLFLVGL  120
RKLGKGDWRG IARNFVVSRT PTQVASHAQK YFIRQSATRK KRRSSLFDMA PDMCPDSTSM  180
PEEQALLPPS ENSQPCNGKS QPSLNLSLKS EYEPMETTSE ENVEETNETS KVLTPMTQRF  240
FPSYLPVPFS IWPSIGAPIE EFNRGETSQY HHQVLKPIPV IPKEPVNVDE LVGMSHLCIG  300
ETQVLDREPS PLSLKLLGEP SRQSAFHANA PVGGSDLNSS KNSAIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF4684860.0EF468486.1 Medicago truncatula MYB transcription factor MYB52 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486782.10.0PREDICTED: uncharacterized protein LOC101494932
TrEMBLG7II010.0G7II01_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-102MYB_related family protein